PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 334aa    MW: 38912.6 Da    PI: 6.8381
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906624.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.31.2e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL+ k ++ a e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010906624.1   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQdKcRIGAdEQHEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPI 100
                     69****************************.9***************943445442455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010906624.1 101 YS-KHNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-616156IPR003441NAC domain
PROSITE profilePS5100560.4677156IPR003441NAC domain
PfamPF023654.8E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDTFSCVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQDKCRIGA  60
DEQHEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKPI YSKHNLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKRVPT VRKPSELDSP CWYDEQLSIL  180
QSQLDSPNSI SIQPNMAYHQ HLQSYKRETK MHYHLPYEPC HQPQLESQKL PNYINHWNSL  240
QSFTSSEDKT VQPTHQLQMV TFYDSSGDID QAVEQVTDWR VLDKFVASQL SHDGTKGPEY  300
NSDTADILQV SSKQEVAVEY ASKSASSCQI DLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-52715715169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906624.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-132NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0G2UF561e-165A0A0G2UF56_MUSPR; Vascular related NAC-domain protein 3
STRINGGSMUA_Achr11P17510_0011e-163(Musa acuminata)
STRINGGSMUA_Achr7P06640_0011e-164(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-111NAC 007